Địa danh có tên miền dài nhất thế giới

Kỷ lục này thuộc về ngôi làng trên đảo Anglesey của xứ Wales với cái tên dài tới 58 ký tự không chứa dấu cách.

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (gọi tắt là Llanfair PG) có nghĩa “nhà thờ thánh Mary tại thung lũng cây phỉ trắng gần xoáy nước và nhà thờ thánh Tysilio”.

Tên miền Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com đã được hãng Internetters đăng ký vào ngày 21/10/1999 và đây trở thành domain địa danh dài nhất.

Do tên miền .com không được phép dài quá 67 ký tự, nó không đủ chỗ để thị trấn Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu tại New Zealand (85 chữ cái) phá kỷ lục của Llanfair PG. Cái tên này được hiểu là “Ngọn đồi nơi Tamatea – người đàn ông có đầu gối to, người leo núi, con chim nhạn của đất liền – thổi sáo cho người mình yêu”.

Tuy nhiên, địa danh này cũng chưa là gì so với Krungthepmahanakornamornratanakosin
mahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamorn
phimarnavatarnsathitsakkattiyavisanukamprasit ở Thái Lan (163 ký tự).

Ngoài ra, việc giới hạn tên miền trong 63 ký tự (thêm .com là 67) đã khiến người sử dụng Internet đua nhau đăng ký những domain ngộ nghĩnh như:

www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com
www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com
www.oooooooooooooooooooooooooooooooooooooooo.com
www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com
www.thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com

  • 02/08/2022
  • Đào Anh
  • Công Nghệ
Facebook xử lý dữ liệu hành vi người dùng như thế nào?

Facebook xử lý dữ liệu hành vi người dùng như thế nào?

Các nhà khoa học của Facebook đang cố gắng tìm hiểu các hành vi của con người thông qua nguồn dữ liệu khổng lồ. Những khám phá của họ có thể giúp mạng xã hội này thu được rất nhiều tiền từ cơ sở dữ liệu khổng lồ đó. Facebook…Xem Thêm

Bị  ” luộc ” linh kiện laptop khi đi sửa chữa

Bị ” luộc ” linh kiện laptop khi đi sửa chữa

Laptop bị hỏng nhẹ, sau khi đi sửa về chạy được vài ngày thì không dùng được nữa. Sơ sẩy là “luộc” Chị Hoàng Anh, nhân viên văn phòng (Q.1, TP.HCM) do bất cẩn trong quá trình sử dụng nên chiếc laptop hiệu Dell bị hỏng ổ cứng và card…Xem Thêm

Tên miền yêu thích đã bị đăng ký bạn giải quyết như thế nào?

Tên miền yêu thích đã bị đăng ký bạn giải quyết như thế nào?

Những tên miền dễ nhớ, độc đáo, đặc trưng theo ngành càng ngày càng khó kiếm. Nghĩ theo hướng tích cực, đây là một bước tiến lớn của thương mại điện tử vì càng lúc càng có nhiều doanh nghiệp quan tâm đến việc đầu tư thương hiệu online. Tuy…Xem Thêm

Doanh nghiệp muốn mở rộng sang thị trường nước ngoài và các vấn đề liên quan tên miền

Doanh nghiệp muốn mở rộng sang thị trường nước ngoài và các vấn đề liên quan tên miền

Từ đầu những năm 2000, tên miền đã được phép đăng ký bởi nhiều ngôn ngữ khác nhau – ví dụ 例子.com là tên miền tiếng Trung hợp lệ. Điều này giúp cho người dùng địa phương ít phụ thuộc hơn vào bảng chữ cái tiếng Anh khi sử dụng…Xem Thêm

Lĩnh vực bất động sản nên chọn tên miền như thế nào?

Lĩnh vực bất động sản nên chọn tên miền như thế nào?

Với hàng triệu tên miền trên internet nói chung và hàng ngàn tên miền bất động sản nói riêng, làm thế nào để gây chú ý cho những khách hàng tiềm năng của công ty bạn? Hãy cùng dichvuwebsite.net tìm hiểu những điều cần lưu ý khi lựa chọn tên…Xem Thêm